PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_144300_iwrp.t1
Common NameSOVF_144300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GATA
Protein Properties Length: 326aa    MW: 36505.9 Da    PI: 8.2038
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_144300_iwrp.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.7e-18238271134
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                        C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Sp_144300_iwrp.t1 238 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 271
                        99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.6E-741320IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.596232268IPR000679Zinc finger, GATA-type
SMARTSM004011.6E-16232282IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.61E-15236295No hitNo description
Gene3DG3DSA:3.30.50.109.2E-15236269IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.94E-15237294No hitNo description
PROSITE patternPS003440238263IPR000679Zinc finger, GATA-type
PfamPF003202.2E-15238271IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MSGTKLMEEI DCANFFDQID DLLEFPNDDV EKNLVDNGAT IDQYNDFPPV FWSENSPVFS  60
SAHSNTASDL SAQLSVPYED IVQLEWLSTF VEDSFAGADL TVDKSQCTSS TKESPRNHFQ  120
ISSPISVLES SSSCSRGNAV PVSHEKRKRA RSKRRRPASF NPRAHPTSSS INETHYSLFT  180
PYPYPYPLLF ESENFVQKKK KKIKILPPSG GISKSQSQSQ NQNENPNANT GSQAVRKCMH  240
CEITKTPQWR AGPMGPKTLC NACGVRYKSG RLFPEYRPAA SPTYIPTIHS NSHKKVLEMR  300
TKPNDDFSCL QEPKLIPKTA LPSPYM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683872.11e-158PREDICTED: GATA transcription factor 8
TrEMBLA0A0K9QV980.0A0A0K9QV98_SPIOL; Uncharacterized protein
STRINGPOPTR_0010s23010.14e-96(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.25e-41GATA family protein